PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009120283.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 356aa    MW: 39055.7 Da    PI: 6.4995
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009120283.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box25.33.2e-081958340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg..Htvv 40
                    +r C+ +++  +  fC+ ++ +lC +C + +H++  H++v
  XP_009120283.1 19 ARSCDACQSVSAAVFCRVDSAFLCLTCDTRIHSYtrHERV 58
                    578******99*********************87889876 PP

2zf-B_box26.71.2e-0859103442
        zf-B_box   4 rkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42 
                       C+ +e+ ++   C+ +   lC +C + +H+       H++vp+
  XP_009120283.1  59 FLCEVCEQAPAAVTCKADAASLCVTCDSDIHSAnplasrHERVPV 103
                     68*****************************66999999999986 PP

3CCT706.1e-24288331144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea++lRY+eKrk+RkFeK+irY+sRKa+AesRpR+KGrF+k++
  XP_009120283.1 288 REARVLRYREKRKNRKFEKTIRYASRKAYAESRPRIKGRFAKRT 331
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003365.5E-81760IPR000315B-box-type zinc finger
PROSITE profilePS501199.9261760IPR000315B-box-type zinc finger
PfamPF006431.6E-62058IPR000315B-box-type zinc finger
CDDcd000213.11E-82060No hitNo description
PROSITE profilePS5011910.66556103IPR000315B-box-type zinc finger
PfamPF006432.1E-659103IPR000315B-box-type zinc finger
CDDcd000214.09E-859103No hitNo description
SMARTSM003365.9E-1061103IPR000315B-box-type zinc finger
PfamPF062035.5E-18288330IPR010402CCT domain
PROSITE profilePS5101716.817288330IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 356 aa     Download sequence    Send to blast
MGFGLENIKS ISGGWGAAAR SCDACQSVSA AVFCRVDSAF LCLTCDTRIH SYTRHERVFL  60
CEVCEQAPAA VTCKADAASL CVTCDSDIHS ANPLASRHER VPVESFFDSA ETAVAKISAS  120
TFGVLGSTPT VDLTAVPVMG NSDELGLCPW LLPNDFSEPA KTEMKSSEFM FSDFDRLIDF  180
EYPNSFNHHP PHNSAGADSL VPVQTKTEPL PLSKNDHCFD IDFCRSKLSA FTYPTQSISH  240
SVSTSSLEYG VVPDGNTSSE ISIPFNRSTT TITASTATTG DQASSMNREA RVLRYREKRK  300
NRKFEKTIRY ASRKAYAESR PRIKGRFAKR TETENDDVFF SHVYASAAQY GVVPTF
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.32880.0bud| leaf| root| seed| silique
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1894790.0AC189479.2 Brassica rapa subsp. pekinensis cultivar Inbred line 'Chiifu' clone KBrB081M20, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009120283.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 5
SwissprotQ9FHH80.0COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A0D3EC700.0A0A0D3EC70_BRAOL; Uncharacterized protein
STRINGAT5G57660.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM78992435
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.10.0CONSTANS-like 5